SCOPe 2.02: Domain d2c2bf_: 2c2b F:

Lineage for d2c2bf_ (2c2b F:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein Threonine synthase [64172] (4 species)

7. Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [64173] (3 PDB entries)

8. Domain d2c2bf_: 2c2b F: [163237]
   automated match to d1e5xa_
   complexed with sam, trs

Details for d2c2bf_

PDB Entry: 2c2b, 2.6 Å

PDB Description: crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine

PDB Compounds: (F:) threonine synthase 1, chloroplastic

SCOPe Domain Sequences for d2c2bf_:

Sequence; same for both SEQRES and ATOM records:

>d2c2bf_ c.79.1.1 (F:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}
vnpfsakyvpfnaapgstesysldeivyrsrsgglldvehdmealkrfdgaywrdlfdsr
vgkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerfgkqflgmndlwvkhcg
ishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaalsaycasagipsivflp
ankismaqlvqpiangafvlsidtdfdgcmklireitaelpiylanslnslrlegqktaa
ieilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdriprmvcaqaananplyl
hyksgwkdfkpmtasttfasaiqigdpvsidravyalkkcngiveeateeelmdamaqad
stgmficphtgvaltalfklrnqgviaptdrtvvvstahglkftqskidyhsnaipdmac
rfsnppvdvkadfgavmdvlksylg

Timeline for d2c2bf_:

• d2c2bf_ first appeared in SCOPe 2.01
  
• d2c2bf_ appears in SCOPe 2.03
  
• d2c2bf_ appears in the current release, SCOPe 2.08