Lineage for d2c1db_ (2c1d B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257168Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1257169Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1257759Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1257760Protein automated matches [190453] (16 species)
    not a true protein
  7. 1257821Species Paracoccus pantotrophus [TaxId:82367] [187503] (3 PDB entries)
  8. 1257826Domain d2c1db_: 2c1d B: [163223]
    automated match to d1h31b_
    complexed with hec, zn

Details for d2c1db_

PDB Entry: 2c1d (more details), 1.92 Å

PDB Description: crystal structure of soxxa from p. pantotrophus
PDB Compounds: (B:) soxx

SCOPe Domain Sequences for d2c1db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1db_ a.3.1.0 (B:) automated matches {Paracoccus pantotrophus [TaxId: 82367]}
cetapkevvyvegaveasltgapgnpeegvrimttnalgncvachqigalpdvefpgtia
ppldgagdrwteaqlrgivanakmtfegtfmpafykvdgfvrpgdgfsgkagaeplapil
naqqiedvvaflvtlke

SCOPe Domain Coordinates for d2c1db_:

Click to download the PDB-style file with coordinates for d2c1db_.
(The format of our PDB-style files is described here.)

Timeline for d2c1db_: