Lineage for d2c1de1 (2c1d E:27-179)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257168Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1257169Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1257759Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1257760Protein automated matches [190453] (16 species)
    not a true protein
  7. 1257812Species Paracoccus denitrificans [TaxId:266] [225029] (1 PDB entry)
  8. 1257817Domain d2c1de1: 2c1d E:27-179 [197829]
    automated match to d1h32a1
    complexed with hec, zn

Details for d2c1de1

PDB Entry: 2c1d (more details), 1.92 Å

PDB Description: crystal structure of soxxa from p. pantotrophus
PDB Compounds: (E:) soxa

SCOPe Domain Sequences for d2c1de1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1de1 a.3.1.0 (E:27-179) automated matches {Paracoccus denitrificans [TaxId: 266]}
dpvedglvietdsgpveivtktappafladtfdtiysgwhfrddstrdlerddfdnpamv
fvdrgldkwnaamgvngescaschqgpesmaglravmprvdehtgklmimedyvnacvte
rmglekwgvtsdnmkdmlslislqsrgmavnvk

SCOPe Domain Coordinates for d2c1de1:

Click to download the PDB-style file with coordinates for d2c1de1.
(The format of our PDB-style files is described here.)

Timeline for d2c1de1: