Lineage for d1cunc2 (1cun C:116-219)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696504Superfamily a.7.1: Spectrin repeat [46966] (2 families) (S)
  5. 2696505Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
    this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
  6. 2696522Protein Spectrin alpha chain [46968] (3 species)
  7. 2696523Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries)
    Uniprot P07751 1662-1981
  8. 2696531Domain d1cunc2: 1cun C:116-219 [16318]
    repeats 16 and 17

Details for d1cunc2

PDB Entry: 1cun (more details), 2 Å

PDB Description: crystal structure of repeats 16 and 17 of chicken brain alpha spectrin
PDB Compounds: (C:) protein (alpha spectrin)

SCOPe Domain Sequences for d1cunc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cunc2 a.7.1.1 (C:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}
qfvanveeeeawinekmtlvasedygdtlaaiqgllkkheafetdftvhkdrvndvcang
edlikknnhhvenitakmkglkgkvsdlekaaaqrkakldensa

SCOPe Domain Coordinates for d1cunc2:

Click to download the PDB-style file with coordinates for d1cunc2.
(The format of our PDB-style files is described here.)

Timeline for d1cunc2: