SCOPe 2.08: Domain d2bv4a_: 2bv4 A:

Lineage for d2bv4a_ (2bv4 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families)

5. Family b.115.1.0: automated matches [191398] (1 protein)
   not a true family

6. Protein automated matches [190521] (2 species)
   not a true protein

7. Species Chromobacterium violaceum [TaxId:536] [187479] (2 PDB entries)

8. Domain d2bv4a_: 2bv4 A: [163169]
   automated match to d1uqxa_
   complexed with ca, mma

Details for d2bv4a_

PDB Entry: 2bv4, 1 Å

PDB Description: 1.0a structure of chromobacterium violaceum lectin in complex with alpha-methyl-mannoside

PDB Compounds: (A:) lectin cv-iil

SCOPe Domain Sequences for d2bv4a_:

Sequence; same for both SEQRES and ATOM records:

>d2bv4a_ b.115.1.0 (A:) automated matches {Chromobacterium violaceum [TaxId: 536]}
aqqgvftlparinfgvtvlvnsaatqhveifvdnepraafsgvgtgdnnlgtkvinsgsg
nvrvqitangrqsdlvssqlvlanklnlavvgsedgtdmdyndsivilnwplg

Timeline for d2bv4a_:

• d2bv4a_ first appeared in SCOPe 2.01
  
• d2bv4a_ appears in SCOPe 2.07