Class a: All alpha proteins [46456] (284 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.1: Spectrin repeat [46966] (2 families) |
Family a.7.1.1: Spectrin repeat [46967] (3 proteins) this is a repeat family; one repeat unit is 1hci A:512-632 found in domain |
Protein Spectrin alpha chain [46968] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries) Uniprot P07751 1662-1981 |
Domain d1cunb2: 1cun B:116-219 [16316] repeats 16 and 17 |
PDB Entry: 1cun (more details), 2 Å
SCOPe Domain Sequences for d1cunb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cunb2 a.7.1.1 (B:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} qfvanveeeeawinekmtlvasedygdtlaaiqgllkkheafetdftvhkdrvndvcang edlikknnhhvenitakmkglkgkvsdlekaaaqrkakldensa
Timeline for d1cunb2:
View in 3D Domains from other chains: (mouse over for more information) d1cuna1, d1cuna2, d1cunc1, d1cunc2 |