Lineage for d2bsba_ (2bsb A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1112704Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1112879Family b.2.3.5: F17c-type adhesin [89215] (3 proteins)
  6. 1112894Protein automated matches [190525] (1 species)
    not a true protein
  7. 1112895Species Escherichia coli [TaxId:562] [187483] (6 PDB entries)
  8. 1112900Domain d2bsba_: 2bsb A: [163156]
    automated match to d1oioa_
    complexed with nag

Details for d2bsba_

PDB Entry: 2bsb (more details), 2.4 Å

PDB Description: e. coli f17e-g lectin domain complex with n-acetylglucosamine
PDB Compounds: (A:) f17g adhesin subunit

SCOPe Domain Sequences for d2bsba_:

Sequence, based on SEQRES records: (download)

>d2bsba_ b.2.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
avsfigstendvgpsqgsysrthamdnlpfvydtgynigyqnanvwhisggfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl
svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt

Sequence, based on observed residues (ATOM records): (download)

>d2bsba_ b.2.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
avsfigstendvgpsqgsyslpfvydtgynigyqnanvwhisggfcvgldgkvdlpvvgs
ldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqglsvhvrpv
ilysvqktsigsirmrpyngssagsvqttvnfslnpftlndt

SCOPe Domain Coordinates for d2bsba_:

Click to download the PDB-style file with coordinates for d2bsba_.
(The format of our PDB-style files is described here.)

Timeline for d2bsba_: