SCOPe 2.06: Domain d1cunb1: 1cun B:7-115

Lineage for d1cunb1 (1cun B:7-115)

Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds)
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
3 helices; bundle, closed, left-handed twist; up-and-down
Superfamily a.7.1: Spectrin repeat [46966] (2 families)
Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
Protein Spectrin alpha chain [46968] (3 species)
Species Chicken (Gallus gallus) [TaxId:9031] [46970] (4 PDB entries)
Uniprot P07751 1662-1981
Domain d1cunb1: 1cun B:7-115 [16315]
repeats 16 and 17

Details for d1cunb1

PDB Description: crystal structure of repeats 16 and 17 of chicken brain alpha spectrin

PDB Compounds: (B:) protein (alpha spectrin)

SCOPe Domain Sequences for d1cunb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cunb1 a.7.1.1 (B:7-115) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]}
mvhqffrdmddeeswikekkllvssedygrdltgvqnlrkkhkrleaelaahepaiqsvl
dtgkklsddntigkeeiqqrlaqfvdhwkelkqlaaargqrleesleyq

SCOPe Domain Coordinates for d1cunb1:

Click to download the PDB-style file with coordinates for d1cunb1.
(The format of our PDB-style files is described here.)

Timeline for d1cunb1: