Lineage for d2bq8x_ (2bq8 X:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998038Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 2998063Protein automated matches [190524] (2 species)
    not a true protein
  7. 2998107Species Human (Homo sapiens) [TaxId:9606] [187482] (2 PDB entries)
  8. 2998109Domain d2bq8x_: 2bq8 X: [163146]
    automated match to d1qhwa_
    complexed with fe2, so4, zn

Details for d2bq8x_

PDB Entry: 2bq8 (more details), 2.2 Å

PDB Description: crystal structure of human purple acid phosphatase with an inhibitory conformation of the repression loop
PDB Compounds: (X:) tartrate-resistant acid phosphatase type 5

SCOPe Domain Sequences for d2bq8x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bq8x_ d.159.1.1 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atpalrfvavgdwggvpnapfhtaremanakeiartvqilgadfilslgdnfyftgvqdi
ndkrfqetfedvfsdrslrkvpwyvlagnhdhlgnvsaqiayskiskrwnfpspfyrlhf
kipqtnvsvaifmldtvtlcgnsddflsqqperprdvklartqlswlkkqlaaaredyvl
vaghypvwsiaehgpthclvkqlrpllatygvtaylcghdhnlqylqdengvgyvlsgag
nfmdpskrhqrkvpngylrfhygtedslggfayveisskemtvtyieasgkslfktrlpr
rarp

SCOPe Domain Coordinates for d2bq8x_:

Click to download the PDB-style file with coordinates for d2bq8x_.
(The format of our PDB-style files is described here.)

Timeline for d2bq8x_: