PDB entry 2bq8

View 2bq8 on RCSB PDB site
Description: Crystal structure of human purple acid phosphatase with an inhibitory conformation of the repression loop
Class: hydrolase
Keywords: metallophosphatase, dinuclear metal site, trap, hydrolase
Deposited on 2005-04-27, released 2005-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: tartrate-resistant acid phosphatase type 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bq8x_
  • Heterogens: FE2, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bq8X (X:)
atpalrfvavgdwggvpnapfhtaremanakeiartvqilgadfilslgdnfyftgvqdi
ndkrfqetfedvfsdrslrkvpwyvlagnhdhlgnvsaqiayskiskrwnfpspfyrlhf
kipqtnvsvaifmldtvtlcgnsddflsqqperprdvklartqlswlkkqlaaaredyvl
vaghypvwsiaehgpthclvkqlrpllatygvtaylcghdhnlqylqdengvgyvlsgag
nfmdpskrhqrkvpngylrfhygtedslggfayveisskemtvtyieasgkslfktrlpr
rarp