SCOPe 2.07: Domain d2bpda_: 2bpd A:

Lineage for d2bpda_ (2bpd A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (20 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (29 PDB entries)

8. Domain d2bpda_: 2bpd A: [163138]
   automated match to d1ypqa1

Details for d2bpda_

PDB Entry: 2bpd, 1.5 Å

PDB Description: structure of murine dectin-1

PDB Compounds: (A:) dectin-1

SCOPe Domain Sequences for d2bpda_:

Sequence; same for both SEQRES and ATOM records:

>d2bpda_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshrin
afwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicntss
ysiceke

Timeline for d2bpda_:

• d2bpda_ first appeared in SCOPe 2.01
  
• d2bpda_ appears in SCOPe 2.06
  
• d2bpda_ appears in the current release, SCOPe 2.08