Lineage for d2bjib_ (2bji B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015828Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 3015829Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 3015830Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 3016081Protein automated matches [190281] (5 species)
    not a true protein
  7. 3016082Species Cow (Bos taurus) [TaxId:9913] [187464] (1 PDB entry)
  8. 3016084Domain d2bjib_: 2bji B: [163107]
    automated match to d1imaa_
    complexed with mg

Details for d2bjib_

PDB Entry: 2bji (more details), 1.24 Å

PDB Description: high resolution structure of myo-inositol monophosphatase, the target of lithium therapy
PDB Compounds: (B:) inositol-1(or 4)-monophosphatase

SCOPe Domain Sequences for d2bjib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjib_ e.7.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dpwqecmdyavtlagqagevvrealknemnimvksspadlvtatdqkvekmlitsikeky
pshsfigeesvaageksiltdnptwiidpidgttnfvhgfpfvavsigfvvnkkmefgiv
yscledkmytgrkgkgafcngqklqvshqeditksllvtelgssrtpetvriilsnierl
lclpihgirgvgtaalnmclvaagaadayyemgihcwdvagagiivteaggvlldvtggp
fdlmsrrviassnktlaeriakeiqiiplqrdded

SCOPe Domain Coordinates for d2bjib_:

Click to download the PDB-style file with coordinates for d2bjib_.
(The format of our PDB-style files is described here.)

Timeline for d2bjib_: