Lineage for d1imaa_ (1ima A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. Protein Inositol monophosphatase [56663] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [56664] (11 PDB entries)
  8. Domain d1imaa_: 1ima A: [42963]
    complexed with gd, ipd

Details for d1imaa_

PDB Entry: 1ima (more details), 2.3 Å

PDB Description: structural analysis of inositol monophosphatase complexes with substrates
PDB Compounds: (A:) inositol monophosphatase

SCOPe Domain Sequences for d1imaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imaa_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]}
wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
lmsrrviaannrilaeriakeiqviplqrdded

SCOPe Domain Coordinates for d1imaa_ are not available.

Timeline for d1imaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1imab_