Lineage for d1xpa_1 (1xpa 134-210)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45974Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
  4. 45975Superfamily a.6.1: Putative DNA-binding domain [46955] (3 families) (S)
  5. 45987Family a.6.1.2: DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain [46959] (1 protein)
  6. 45988Protein DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain [46960] (1 species)
  7. 45989Species Human (Homo sapiens) [TaxId:9606] [46961] (2 PDB entries)
  8. 45991Domain d1xpa_1: 1xpa 134-210 [16308]
    Other proteins in same PDB: d1xpa_2

Details for d1xpa_1

PDB Entry: 1xpa (more details)

PDB Description: solution structure of the dna-and rpa-binding domain of the human repair factor xpa, nmr, 1 structure

SCOP Domain Sequences for d1xpa_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpa_1 a.6.1.2 (134-210) DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain {Human (Homo sapiens)}
dkhklitkteakqeyllkdcdlekrepplkfivkknphhsqwgdmklylklqivkrslev
wgsqealeeakevrqen

SCOP Domain Coordinates for d1xpa_1:

Click to download the PDB-style file with coordinates for d1xpa_1.
(The format of our PDB-style files is described here.)

Timeline for d1xpa_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xpa_2