Lineage for d1xpaa1 (1xpa A:134-210)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696351Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2696352Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2696380Family a.6.1.2: DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain [46959] (1 protein)
  6. 2696381Protein DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain [46960] (1 species)
  7. 2696382Species Human (Homo sapiens) [TaxId:9606] [46961] (2 PDB entries)
  8. 2696383Domain d1xpaa1: 1xpa A:134-210 [16308]
    Other proteins in same PDB: d1xpaa2
    complexed with zn

Details for d1xpaa1

PDB Entry: 1xpa (more details)

PDB Description: solution structure of the dna-and rpa-binding domain of the human repair factor xpa, nmr, 1 structure
PDB Compounds: (A:) xpa

SCOPe Domain Sequences for d1xpaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpaa1 a.6.1.2 (A:134-210) DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
dkhklitkteakqeyllkdcdlekrepplkfivkknphhsqwgdmklylklqivkrslev
wgsqealeeakevrqen

SCOPe Domain Coordinates for d1xpaa1:

Click to download the PDB-style file with coordinates for d1xpaa1.
(The format of our PDB-style files is described here.)

Timeline for d1xpaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xpaa2