SCOPe 2.08: Domain d1xpaa1: 1xpa A:134-210

Lineage for d1xpaa1 (1xpa A:134-210)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.2: DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain [46959] (1 protein)

6. Protein DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain [46960] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46961] (2 PDB entries)

8. Domain d1xpaa1: 1xpa A:134-210 [16308]
   Other proteins in same PDB: d1xpaa2
   complexed with zn

Details for d1xpaa1

PDB Entry: 1xpa

PDB Description: solution structure of the dna-and rpa-binding domain of the human repair factor xpa, nmr, 1 structure

PDB Compounds: (A:) xpa

SCOPe Domain Sequences for d1xpaa1:

Sequence; same for both SEQRES and ATOM records:

>d1xpaa1 a.6.1.2 (A:134-210) DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
dkhklitkteakqeyllkdcdlekrepplkfivkknphhsqwgdmklylklqivkrslev
wgsqealeeakevrqen

Timeline for d1xpaa1:

• d1xpaa1 first appeared (with stable ids) in SCOP 1.55, called d1xpa_1
  
• d1xpaa1 appears in SCOPe 2.07