Lineage for d2b9uk_ (2b9u K:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1558339Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1558340Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1558341Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)
  6. 1558342Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
    synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
  7. 1558381Species Sulfolobus tokodaii [TaxId:111955] [141586] (2 PDB entries)
    Uniprot Q96Z62 1-176
  8. 1558394Domain d2b9uk_: 2b9u K: [163028]
    automated match to d1wlta1

Details for d2b9uk_

PDB Entry: 2b9u (more details), 2.07 Å

PDB Description: Crystal structure of dTDP-4-dehydrorhamnose 3,5-epimerase from sulfolobus tokodaii
PDB Compounds: (K:) hypothetical dTDP-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d2b9uk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9uk_ b.82.1.1 (K:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Sulfolobus tokodaii [TaxId: 111955]}
mpfefenlgmgiilikpkvfpdkrgfflevfksedftkmripnviqtnmsfsrkgvvrgl
hyqrtpkeqgkiifvpkgrildvavdvrkssptfgkyvkaelneenhymlwippgfahgf
qaledsiviyfithneyspphercisysyidwpikeviisdkdlqcpslekaevfd

SCOPe Domain Coordinates for d2b9uk_:

Click to download the PDB-style file with coordinates for d2b9uk_.
(The format of our PDB-style files is described here.)

Timeline for d2b9uk_: