SCOPe 2.02: Domain d2b34e_: 2b34 E:

Lineage for d2b34e_ (2b34 E:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (7 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187443] (1 PDB entry)

8. Domain d2b34e_: 2b34 E: [162980]
   automated match to d1x9ga_

Details for d2b34e_

PDB Entry: 2b34, 2.14 Å

PDB Description: Structure of MAR1 Ribonuclease from Caenorhabditis elegans

PDB Compounds: (E:) MAR1 Ribonuclease

SCOPe Domain Sequences for d2b34e_:

Sequence; same for both SEQRES and ATOM records:

>d2b34e_ c.33.1.0 (E:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
arinptnsalfvcdlqekfasnikyfpeiittsrrlidaarilsiptivteqypkglght
vptlkeglaentpifdktkfsmcipptedtlkkvqnvilvgieahvcvlqttydllergl
nvhvvvdavssrshtdrhfafkqmeqagailttseatilglvggsdhpkfkevqklilts
apdtglvplskl

Timeline for d2b34e_:

• d2b34e_ first appeared in SCOPe 2.01
  
• d2b34e_ appears in SCOPe 2.03
  
• d2b34e_ appears in the current release, SCOPe 2.08