Lineage for d2b16a_ (2b16 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113483Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1113484Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
  6. 1113485Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 1113506Species Human (Homo sapiens) [TaxId:9606] [49475] (150 PDB entries)
    Uniprot P02766 31-143
  8. 1113611Domain d2b16a_: 2b16 A: [162962]
    automated match to d1eta1_
    complexed with dnf

Details for d2b16a_

PDB Entry: 2b16 (more details), 1.75 Å

PDB Description: the crystal structure of 2,4-dinitrophenol in complex with the amyloidogenic variant transthyretin tyr78phe
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d2b16a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b16a_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksfwkalgispfhehaevvftandsgprrytiaallspysysttavvtn

SCOPe Domain Coordinates for d2b16a_:

Click to download the PDB-style file with coordinates for d2b16a_.
(The format of our PDB-style files is described here.)

Timeline for d2b16a_: