SCOPe 2.02: Domain d2b02a_: 2b02 A:

Lineage for d2b02a_ (2b02 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187434] (9 PDB entries)

8. Domain d2b02a_: 2b02 A: [162954]
   automated match to d1p97a_

Details for d2b02a_

PDB Entry: 2b02, 1.5 Å

PDB Description: crystal structure of arnt pas-b domain

PDB Compounds: (A:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d2b02a_:

Sequence; same for both SEQRES and ATOM records:

>d2b02a_ d.110.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msnvsqptefisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfq
qvvklkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnv

Timeline for d2b02a_:

• d2b02a_ first appeared in SCOPe 2.01
  
• d2b02a_ appears in SCOPe 2.03
  
• d2b02a_ appears in the current release, SCOPe 2.08