SCOPe 2.08: Domain d2azcb_: 2azc B:

Lineage for d2azcb_ (2azc B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d2azcb_: 2azc B: [162949]
   automated match to d1k6ca_
   complexed with 3tl; mutant

Details for d2azcb_

PDB Entry: 2azc, 2.01 Å

PDB Description: hiv-1 protease nl4-3 6x mutant

PDB Compounds: (B:) protease retropepsin

SCOPe Domain Sequences for d2azcb_:

Sequence; same for both SEQRES and ATOM records:

>d2azcb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealidtgaddtvleemnlpgrwkpkiiggigglikvrqyd
qipieicghkaigtvligptpaniigrnlltqigctlnf

Timeline for d2azcb_:

• d2azcb_ first appeared in SCOPe 2.01
  
• d2azcb_ appears in SCOPe 2.07