Lineage for d2awma_ (2awm A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1643322Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1643323Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1643324Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1643328Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 1643334Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (160 PDB entries)
    Uniprot P42212
  8. 1643439Domain d2awma_: 2awm A: [162930]
    automated match to d1qyfa_
    complexed with mg; mutant

Details for d2awma_

PDB Entry: 2awm (more details), 1.7 Å

PDB Description: gfp r96a chromophore maturation recovery mutant r96a q183r
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d2awma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awma_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tlgygvqcfsrypdhmkqhdffksampegyvqeatisfkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhy
rqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

SCOPe Domain Coordinates for d2awma_:

Click to download the PDB-style file with coordinates for d2awma_.
(The format of our PDB-style files is described here.)

Timeline for d2awma_: