Class b: All beta proteins [48724] (176 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein automated matches [190163] (13 species) not a true protein |
Species Rhodnius prolixus [TaxId:13249] [187425] (3 PDB entries) |
Domain d2at3x_: 2at3 X: [162893] automated match to d1d2ua_ complexed with hem, imd; mutant |
PDB Entry: 2at3 (more details), 1 Å
SCOPe Domain Sequences for d2at3x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2at3x_ b.60.1.1 (X:) automated matches {Rhodnius prolixus [TaxId: 13249]} actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih tcvhkgnkdlgdvyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks lltk
Timeline for d2at3x_: