Lineage for d1f4ia_ (1f4i A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696034Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2696044Protein DNA repair protein Hhr23a [46936] (1 species)
  7. 2696045Species Human (Homo sapiens) [TaxId:9606] [46937] (9 PDB entries)
  8. 2696054Domain d1f4ia_: 1f4i A: [16288]
    C-terminal UBA domain
    mutant

Details for d1f4ia_

PDB Entry: 1f4i (more details)

PDB Description: solution structure of the hhr23a uba(2) mutant p333e, deficient in binding the hiv-1 accessory protein vpr
PDB Compounds: (A:) uv excision repair protein protein rad23 homolog a

SCOPe Domain Sequences for d1f4ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4ia_ a.5.2.1 (A:) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]}
qekeaierlkalgfeeslviqayfaceknenlaanfllsqnfdde

SCOPe Domain Coordinates for d1f4ia_:

Click to download the PDB-style file with coordinates for d1f4ia_.
(The format of our PDB-style files is described here.)

Timeline for d1f4ia_: