SCOPe 2.05: Domain d2aorb_: 2aor B:

Lineage for d2aorb_ (2aor B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.14: DNA mismatch repair protein MutH from [53020] (2 proteins)

6. Protein automated matches [190482] (1 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:727] [187414] (2 PDB entries)

8. Domain d2aorb_: 2aor B: [162847]
   automated match to d2azoa_
   protein/DNA complex; complexed with ca

Details for d2aorb_

PDB Entry: 2aor, 2 Å

PDB Description: Crystal structure of MutH-hemimethylated DNA complex

PDB Compounds: (B:) DNA mismatch repair protein mutH

SCOPe Domain Sequences for d2aorb_:

Sequence; same for both SEQRES and ATOM records:

>d2aorb_ c.52.1.14 (B:) automated matches {Haemophilus influenzae [TaxId: 727]}
mipqtleqllsqaqsiagltfgeladelhipvpidlkrdkgwvgmlleralgatagskae
qdfshlgvelktlpinaegyplettfvslaplvqnsgvkwenshvrhklscvlwmpiegs
rhiplrerhigapifwkptaeqerqlkqdweelmdlivlgkldqitarigevmqlrpkga
nsravtkgigkngeiidtlplgfylrkeftaqilnafletk

Timeline for d2aorb_:

• d2aorb_ first appeared in SCOPe 2.01
  
• d2aorb_ appears in SCOPe 2.04
  
• d2aorb_ appears in SCOPe 2.06
  
• d2aorb_ appears in the current release, SCOPe 2.08