Lineage for d2aora_ (2aor A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856505Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1856506Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1856700Family c.52.1.14: DNA mismatch repair protein MutH from [53020] (2 proteins)
  6. 1856706Protein automated matches [190482] (1 species)
    not a true protein
  7. 1856707Species Haemophilus influenzae [TaxId:727] [187414] (2 PDB entries)
  8. 1856708Domain d2aora_: 2aor A: [162846]
    automated match to d2azoa_
    protein/DNA complex; complexed with ca

Details for d2aora_

PDB Entry: 2aor (more details), 2 Å

PDB Description: Crystal structure of MutH-hemimethylated DNA complex
PDB Compounds: (A:) DNA mismatch repair protein mutH

SCOPe Domain Sequences for d2aora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aora_ c.52.1.14 (A:) automated matches {Haemophilus influenzae [TaxId: 727]}
mipqtleqllsqaqsiagltfgeladelhipvpidlkrdkgwvgmlleralgatagskae
qdfshlgvelktlpinaegyplettfvslaplvqnsgvkwenshvrhklscvlwmpiegs
rhiplrerhigapifwkptaeqerqlkqdweelmdlivlgkldqitarigevmqlrpkga
nsravtkgigkngeiidtlplgfylrkeftaqilnaflet

SCOPe Domain Coordinates for d2aora_:

Click to download the PDB-style file with coordinates for d2aora_.
(The format of our PDB-style files is described here.)

Timeline for d2aora_: