Lineage for d2an2a_ (2an2 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1227278Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1227279Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 1227280Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1227678Protein automated matches [190421] (4 species)
    not a true protein
  7. 1227679Species Bacillus subtilis [TaxId:1423] [187412] (3 PDB entries)
  8. 1227683Domain d2an2a_: 2an2 A: [162842]
    automated match to d1m7va_
    complexed with arg, h4b, hem; mutant

Details for d2an2a_

PDB Entry: 2an2 (more details), 2.6 Å

PDB Description: p332g, a333s double mutant of the bacillus subtilis nitric oxide synthase
PDB Compounds: (A:) P332G A333S double mutant of Nitric Oxide Synthase from Bacillus subtilis

SCOPe Domain Sequences for d2an2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2an2a_ d.174.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
shaailwneakafiaecyaelgkaeevadrldsikseidltgsyvhtkeelehgakmawr
nsnrcigrlfwnslnvidrrdvrtkedvrdalfhhietatnngkirpsitifppeekgek
qveiwnhqliryagyegeaigdpascsltaaceqlgwrgertdfdllplifrmkgdeqpv
wyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymgte
igarnladekrydklkkvasvigistnyntdlwkdqalvelnkavlysykkqgvsivdhh
taasqfkrfeeqeeeagrkltgdwtwlippisgsathifhrsydnsivkpnyfyqdkpye

SCOPe Domain Coordinates for d2an2a_:

Click to download the PDB-style file with coordinates for d2an2a_.
(The format of our PDB-style files is described here.)

Timeline for d2an2a_: