SCOPe 2.01: Domain d2agzd_: 2agz D:

Lineage for d2agzd_ (2agz D:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.0: automated matches [191380] (1 protein)
   not a true family

6. Protein automated matches [190474] (1 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)

8. Domain d2agzd_: 2agz D: [162793]
   automated match to d1mg2b_
   complexed with tsc, zn

Details for d2agzd_

PDB Entry: 2agz, 1.6 Å

PDB Description: Crystal structure of the carbinolamine intermediate in the reductive half-reaction of aromatic amine dehydrogenase (AADH) with tryptamine. F222 form

PDB Compounds: (D:) Aromatic amine dehydrogenase

SCOPe Domain Sequences for d2agzd_:

Sequence; same for both SEQRES and ATOM records:

>d2agzd_ g.21.1.0 (D:) automated matches {Alcaligenes faecalis [TaxId: 511]}
evnscdywrhcavdgflcsccggttttcppgstpspiswigtchnphdgkdylisyhdcc
gktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlvgl

Timeline for d2agzd_:

• d2agzd_ is new in SCOPe 2.01-stable
  
• d2agzd_ appears in SCOPe 2.02
  
• d2agzd_ appears in the current release, SCOPe 2.08