Lineage for d2agdb_ (2agd B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1614914Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1614915Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1614924Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 1614964Protein automated matches [190297] (2 species)
    not a true protein
  7. 1614968Species Human (Homo sapiens) [TaxId:9606] [187395] (17 PDB entries)
  8. 1614973Domain d2agdb_: 2agd B: [162782]
    automated match to d1tvya_
    complexed with dio, gol, mes, mn, so4, udh

Details for d2agdb_

PDB Entry: 2agd (more details), 1.9 Å

PDB Description: crystal structure of human m340h-beta-1,4-galactosyltransferase- i(m340h-b4gal-t1) in complex with glcnac-beta1,4-man-alpha1,3-man- beta-or
PDB Compounds: (B:) Beta-1,4-galactosyltransferase 1

SCOPe Domain Sequences for d2agdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2agdb_ c.68.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfr
nrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfv
fsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpn
nywgwggedddifnrlvfrgmsisrpnavvgttrhirhsrdkknepnpqrfdriahtket
mlsdglnsltyqvldvqryplytqitvdigtps

SCOPe Domain Coordinates for d2agdb_:

Click to download the PDB-style file with coordinates for d2agdb_.
(The format of our PDB-style files is described here.)

Timeline for d2agdb_: