Lineage for d1bdxb1 (1bdx B:156-203)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1480920Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1480921Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family) (S)
    possibly related to UBA-like domains
  5. 1480922Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein)
  6. 1480923Protein DNA helicase RuvA subunit, C-terminal domain [46931] (3 species)
    tetramer; binds Holliday junction
  7. 1480924Species Escherichia coli [TaxId:562] [46932] (4 PDB entries)
  8. 1480929Domain d1bdxb1: 1bdx B:156-203 [16277]
    Other proteins in same PDB: d1bdxa2, d1bdxa3, d1bdxb2, d1bdxb3, d1bdxc2, d1bdxc3, d1bdxd2, d1bdxd3
    protein/DNA complex

Details for d1bdxb1

PDB Entry: 1bdx (more details), 6 Å

PDB Description: e. coli dna helicase ruva with bound dna holliday junction, alpha carbons and phosphate atoms only
PDB Compounds: (B:) holliday junction DNA helicase ruva

SCOPe Domain Sequences for d1bdxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdxb1 a.5.1.1 (B:156-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli [TaxId: 562]}
tddaeqeavaalvalgykpqeasrmvskiarpdassetlirealraal

SCOPe Domain Coordinates for d1bdxb1:

Click to download the PDB-style file with coordinates for d1bdxb1.
(The format of our PDB-style files is described here.)

Timeline for d1bdxb1: