Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (29 species) not a true protein |
Species Rotavirus a [TaxId:10941] [187397] (1 PDB entry) |
Domain d2aend_: 2aen D: [162768] automated match to d1kqra_ complexed with eoh, gol |
PDB Entry: 2aen (more details), 1.6 Å
SCOPe Domain Sequences for d2aend_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aend_ b.29.1.0 (D:) automated matches {Rotavirus a [TaxId: 10941]} tvepvldgpyqpttfkppndywllissntngvvyestnnndfwtaviavephvsqtnrqy ilfgenkqfnvennsdkwkffemfkgssqgdfsnrrtltssnrlvgmlkyggrvwtfhge tprattdssntadlnnisiiihsefyiiprsqeskcneyinngl
Timeline for d2aend_: