Lineage for d2acoa_ (2aco A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1551689Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1552080Protein automated matches [190163] (13 species)
    not a true protein
  7. 1552102Species Escherichia coli [TaxId:562] [187394] (1 PDB entry)
  8. 1552103Domain d2acoa_: 2aco A: [162756]
    automated match to d1qwda_
    complexed with vca

Details for d2acoa_

PDB Entry: 2aco (more details), 1.8 Å

PDB Description: Xray structure of Blc dimer in complex with vaccenic acid
PDB Compounds: (A:) Outer membrane lipoprotein blc

SCOPe Domain Sequences for d2acoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2acoa_ b.60.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
hlestslykkagstpprgvtvvnnfdakrylgtwyeiarfdhrferglekvtatyslrdd
gglnvinkgynpdrgmwqqsegkayftgaptraalkvsffgpfyggynvialdreyrhal
vcgpdrdylwilsrtptisdevkqemlavatregfdvskfiwvqqpgs

SCOPe Domain Coordinates for d2acoa_:

Click to download the PDB-style file with coordinates for d2acoa_.
(The format of our PDB-style files is described here.)

Timeline for d2acoa_: