Lineage for d2a5aa_ (2a5a A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795288Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)
  6. 1795345Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 1795366Species SARS coronavirus [TaxId:227859] [89349] (65 PDB entries)
  8. 1795415Domain d2a5aa_: 2a5a A: [162692]
    automated match to d1uj1b_
    complexed with cl, edo

Details for d2a5aa_

PDB Entry: 2a5a (more details), 2.08 Å

PDB Description: crystal structure of unbound sars coronavirus main peptidase in the space group c2
PDB Compounds: (A:) 3C-like peptidase

SCOPe Domain Sequences for d2a5aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5aa_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq

SCOPe Domain Coordinates for d2a5aa_:

Click to download the PDB-style file with coordinates for d2a5aa_.
(The format of our PDB-style files is described here.)

Timeline for d2a5aa_: