SCOP 1.71: Domain d1wjba_: 1wjb A:

Lineage for d1wjba_ (1wjb A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (1 family)

5. Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein)
   Zn-binding site is near the C-terminus

6. Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (7 PDB entries)

8. Domain d1wjba_: 1wjb A: [16265]

Details for d1wjba_

PDB Entry: 1wjb

PDB Description: solution structure of the n-terminal zn binding domain of hiv-1 integrase (d form), nmr, 40 structures

SCOP Domain Sequences for d1wjba_:

Sequence; same for both SEQRES and ATOM records:

>d1wjba_ a.4.10.1 (A:) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1}
fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvd

Timeline for d1wjba_:

• d1wjba_ first appeared (with stable ids) in SCOP 1.55
  
• d1wjba_ appears in SCOP 1.69
  
• d1wjba_ appears in SCOP 1.73
  
• d1wjba_ appears in the current release, SCOPe 2.08