PDB entry 1wjb

View 1wjb on RCSB PDB site
Description: solution structure of the n-terminal zn binding domain of hiv-1 integrase (d form), nmr, 40 structures
Deposited on 1997-05-13, released 1998-05-13
The last revision prior to the SCOP 1.71 freeze date was dated 1998-05-13, with a file datestamp of 1998-05-13.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wjba_
  • Chain 'B':
    Domains in SCOP 1.71: d1wjbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wjbA (A:)
fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wjbB (B:)
fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvd