Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.0: automated matches [191483] (1 protein) not a true family |
Protein automated matches [190775] (3 species) not a true protein |
Species Human herpesvirus 8 [TaxId:37296] [188205] (1 PDB entry) |
Domain d1zxta_: 1zxt A: [162623] automated match to d1hhva_ |
PDB Entry: 1zxt (more details), 1.7 Å
SCOPe Domain Sequences for d1zxta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxta_ d.9.1.0 (A:) automated matches {Human herpesvirus 8 [TaxId: 37296]} vsytpnsccygfqqhpppvqilkewyptspacpkpgvilltkrgrqicadpsknwvrqlm qrlpaiahh
Timeline for d1zxta_: