SCOPe 2.05: Domain d1zxta_: 1zxt A:

Lineage for d1zxta_ (1zxt A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.0: automated matches [191483] (1 protein)
   not a true family

6. Protein automated matches [190775] (3 species)
   not a true protein

7. Species Human herpesvirus 8 [TaxId:37296] [188205] (1 PDB entry)

8. Domain d1zxta_: 1zxt A: [162623]
   automated match to d1hhva_

Details for d1zxta_

PDB Entry: 1zxt, 1.7 Å

PDB Description: Crystal Structure of A Viral Chemokine

PDB Compounds: (A:) functional macrophage inflammatory protein 1-alpha homolog

SCOPe Domain Sequences for d1zxta_:

Sequence; same for both SEQRES and ATOM records:

>d1zxta_ d.9.1.0 (A:) automated matches {Human herpesvirus 8 [TaxId: 37296]}
vsytpnsccygfqqhpppvqilkewyptspacpkpgvilltkrgrqicadpsknwvrqlm
qrlpaiahh

Timeline for d1zxta_:

• d1zxta_ first appeared in SCOPe 2.01
  
• d1zxta_ appears in SCOPe 2.04
  
• d1zxta_ is called d1zxta1 in SCOPe 2.06
  
• d1zxta_ appears in the current release, SCOPe 2.08, called d1zxta1