SCOPe 2.08: Domain d1zt3a_: 1zt3 A:

Lineage for d1zt3a_ (1zt3 A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily)
   disulfide-rich, alpha+beta

4. Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (2 families)

5. Family g.28.1.1: Thyroglobulin type-1 domain [57611] (5 proteins)
   Pfam PF00086

6. Protein automated matches [190610] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187632] (3 PDB entries)

8. Domain d1zt3a_: 1zt3 A: [162579]
   automated match to d2dsqg1
   complexed with dio

Details for d1zt3a_

PDB Entry: 1zt3, 1.8 Å

PDB Description: c-terminal domain of insulin-like growth factor binding protein-1 isolated from human amniotic fluid

PDB Compounds: (A:) Insulin-like growth factor binding protein 1

SCOPe Domain Sequences for d1zt3a_:

Sequence; same for both SEQRES and ATOM records:

>d1zt3a_ g.28.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wkepcrielyrvveslakaqetsgeeiskfylpncnkngfyhsrqcetsmdgeaglcwcv
ypwngkripgspeirgdpnc

Timeline for d1zt3a_:

• d1zt3a_ first appeared in SCOPe 2.01
  
• d1zt3a_ appears in SCOPe 2.07