SCOPe 2.02: Domain d1zh7b_: 1zh7 B:

Lineage for d1zh7b_ (1zh7 B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Orphan nuclear receptor NR5a2 (LRH-1) [89147] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [89148] (2 PDB entries)

8. Domain d1zh7b_: 1zh7 B: [162475]
   automated match to d1pk5a_

Details for d1zh7b_

PDB Entry: 1zh7, 2.5 Å

PDB Description: structural and biochemical basis for selective repression of the orphan nuclear receptor lrh-1 by shp

PDB Compounds: (B:) Orphan nuclear receptor NR5A2

SCOPe Domain Sequences for d1zh7b_:

Sequence; same for both SEQRES and ATOM records:

>d1zh7b_ a.123.1.1 (B:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]}
asiphlilellkcepdepqvqakimaylqqeqsnrnrqeklsafgllckmadqtlfsive
warssiffrelkvddqmkllqncwsellildhiyrqvahgkegtiflvtgehvdystiis
htevafnnllslaqelvvrlrslqfdqrefvclkflvlfssdvknlenlqlvegvqeqvn
aalldytvcnypqqtekfgqlllrlpeiraiskqaedylyykhvngdvpynnlliemlha
kra

Timeline for d1zh7b_:

• d1zh7b_ first appeared in SCOPe 2.01
  
• d1zh7b_ appears in SCOPe 2.03
  
• d1zh7b_ appears in the current release, SCOPe 2.08