Lineage for d1zcpa_ (1zcp A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484065Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2484131Protein Thioredoxin [52835] (16 species)
  7. 2484153Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 2484205Domain d1zcpa_: 1zcp A: [162445]
    automated match to d1f6mc_
    mutant

Details for d1zcpa_

PDB Entry: 1zcp (more details), 2.3 Å

PDB Description: crystal structure of a catalytic site mutant e. coli trxa (caca)
PDB Compounds: (A:) Thioredoxin 1

SCOPe Domain Sequences for d1zcpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcpa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
dkiihltddsfdtdvlkadgailvdfwaewcacakmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

SCOPe Domain Coordinates for d1zcpa_:

Click to download the PDB-style file with coordinates for d1zcpa_.
(The format of our PDB-style files is described here.)

Timeline for d1zcpa_: