SCOPe 2.08: Domain d1z9za1: 1z9z A:4-60

Lineage for d1z9za1 (1z9z A:4-60)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187372] (12 PDB entries)

8. Domain d1z9za1: 1z9z A:4-60 [162426]
   Other proteins in same PDB: d1z9za2, d1z9zb2
   automated match to d1fyna_
   complexed with so4

Details for d1z9za1

PDB Entry: 1z9z, 1.95 Å

PDB Description: crystal structure of yeast sla1 sh3 domain 3

PDB Compounds: (A:) Cytoskeleton assembly control protein SLA1

SCOPe Domain Sequences for d1z9za1:

Sequence; same for both SEQRES and ATOM records:

>d1z9za1 b.34.2.0 (A:4-60) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rgivqydfmaesqdeltiksgdkvyilddkkskdwwmcqlvdsgksglvpaqfiepv

Timeline for d1z9za1:

• d1z9za1 first appeared in SCOPe 2.01, called d1z9za_
  
• d1z9za1 appears in SCOPe 2.07