| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
| Protein automated matches [190457] (10 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187372] (12 PDB entries) |
| Domain d1z9zb1: 1z9z B:4-60 [162427] Other proteins in same PDB: d1z9za2, d1z9zb2 automated match to d1fyna_ complexed with so4 |
PDB Entry: 1z9z (more details), 1.95 Å
SCOPe Domain Sequences for d1z9zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z9zb1 b.34.2.0 (B:4-60) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rgivqydfmaesqdeltiksgdkvyilddkkskdwwmcqlvdsgksglvpaqfiepv
Timeline for d1z9zb1: