Lineage for d1z3ub1 (1z3u B:281-495)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. Family d.171.1.0: automated matches [191465] (1 protein)
    not a true family
  6. Protein automated matches [190726] (1 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187887] (55 PDB entries)
  8. Domain d1z3ub1: 1z3u B:281-495 [162374]
    Other proteins in same PDB: d1z3ua2, d1z3ub2, d1z3uc2, d1z3ud2
    automated match to d1jc9a_
    complexed with ca

Details for d1z3ub1

PDB Entry: 1z3u (more details), 2.25 Å

PDB Description: Structure of the Angiopoietin-2 Recptor Binding Domain and Identification of Surfaces Involved in Tie2 Recognition
PDB Compounds: (B:) Angiopoietin-2

SCOPe Domain Sequences for d1z3ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3ub1 d.171.1.0 (B:281-495) automated matches {Human (Homo sapiens) [TaxId: 9606]}
frdcaevfksghttngiytltfpnsteeikaycdmeaggggwtiiqrredgsvdfqrtwk
eykvgfgnpsgeywlgnefvsqltnqqryvlkihlkdwegneayslyehfylsseelnyr
ihlkgltgtagkissisqpgndfstkdgdndkcickcsqmltggwwfdacgpsnlngmyy
pqrqntnkangikwaawkgsgyslkattmmirpad

SCOPe Domain Coordinates for d1z3ub1 are not available.

Timeline for d1z3ub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z3ub2
View in 3D
Domains from other chains:
(mouse over for more information)
d1z3ua1, d1z3ua2, d1z3uc1, d1z3uc2, d1z3ud1, d1z3ud2