SCOPe 2.08: Domain d1z3ua1: 1z3u A:281-495

Lineage for d1z3ua1 (1z3u A:281-495)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families)

5. Family d.171.1.0: automated matches [191465] (1 protein)
   not a true family

6. Protein automated matches [190726] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187887] (56 PDB entries)

8. Domain d1z3ua1: 1z3u A:281-495 [162373]
   Other proteins in same PDB: d1z3ua2, d1z3ub2, d1z3uc2, d1z3ud2
   automated match to d1jc9a_
   complexed with ca

Details for d1z3ua1

PDB Entry: 1z3u, 2.25 Å

PDB Description: structure of the angiopoietin-2 recptor binding domain and identification of surfaces involved in tie2 recognition

PDB Compounds: (A:) Angiopoietin-2

SCOPe Domain Sequences for d1z3ua1:

Sequence; same for both SEQRES and ATOM records:

>d1z3ua1 d.171.1.0 (A:281-495) automated matches {Human (Homo sapiens) [TaxId: 9606]}
frdcaevfksghttngiytltfpnsteeikaycdmeaggggwtiiqrredgsvdfqrtwk
eykvgfgnpsgeywlgnefvsqltnqqryvlkihlkdwegneayslyehfylsseelnyr
ihlkgltgtagkissisqpgndfstkdgdndkcickcsqmltggwwfdacgpsnlngmyy
pqrqntnkangikwaawkgsgyslkattmmirpad

Timeline for d1z3ua1:

• d1z3ua1 first appeared in SCOPe 2.01, called d1z3ua_
  
• d1z3ua1 appears in SCOPe 2.07