SCOPe 2.03: Domain d1yvja_: 1yvj A:

Lineage for d1yvja_ (1yvj A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (314 PDB entries)

8. Domain d1yvja_: 1yvj A: [162312]
   automated match to d1u54a_
   complexed with 4st, dtv

Details for d1yvja_

PDB Entry: 1yvj, 2.55 Å

PDB Description: Crystal structure of the Jak3 kinase domain in complex with a staurosporine analogue

PDB Compounds: (A:) Tyrosine-protein kinase JAK3

SCOPe Domain Sequences for d1yvja_:

Sequence; same for both SEQRES and ATOM records:

>d1yvja_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptifeerhlkyisqlgkgnfgsvelcrydplgdntgalvavkqlqhsgpdqqrdfqreiq
ilkalhsdfivkyrgvsygpgrpelrlvmeylpsgclrdflqrhrarldasrlllyssqi
ckgmeylgsrrcvhrdlaarnilveseahvkiadfglakllpldkdyyvvrepgqspifw
yapeslsdnifsrqsdvwsfgvvlyelftycdkscspsaeflrmmgcerdvpalcrllel
leegqrlpappacpaevhelmklcwapspqdrpsfsalgpqldmlwsgsr

Timeline for d1yvja_:

• d1yvja_ first appeared in SCOPe 2.01
  
• d1yvja_ appears in SCOPe 2.02
  
• d1yvja_ appears in SCOPe 2.04
  
• d1yvja_ appears in the current release, SCOPe 2.08