PDB entry 1yvj

View 1yvj on RCSB PDB site
Description: Crystal structure of the Jak3 kinase domain in complex with a staurosporine analogue
Class: transferase
Keywords: tyrosine kinase; scid; severe combined immunodeficiency; stat5; stat6; interleukin-2; common-gamma chain, transferase
Deposited on 2005-02-15, released 2005-05-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.204
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase JAK3
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52333 (0-289)
      • conflict (81)
      • modified residue (166-167)
    Domains in SCOPe 2.03: d1yvja_
  • Heterogens: DTV, 4ST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yvjA (A:)
    ptifeerhlkyisqlgkgnfgsvelcrydplgdntgalvavkqlqhsgpdqqrdfqreiq
    ilkalhsdfivkyrgvsygpgrpelrlvmeylpsgclrdflqrhrarldasrlllyssqi
    ckgmeylgsrrcvhrdlaarnilveseahvkiadfglakllpldkdyyvvrepgqspifw
    yapeslsdnifsrqsdvwsfgvvlyelftycdkscspsaeflrmmgcerdvpalcrllel
    leegqrlpappacpaevhelmklcwapspqdrpsfsalgpqldmlwsgsr