SCOPe 2.08: Domain d1tnsa_: 1tns A:

Lineage for d1tnsa_ (1tns A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.7: Excisionase-like [46891] (2 proteins)
   kinked C-terminal helix

6. Protein mu transposase, DNA-binding domain [46892] (1 species)

7. Species Bacteriophage Mu [TaxId:10677] [46893] (4 PDB entries)

8. Domain d1tnsa_: 1tns A: [16228]

Details for d1tnsa_

PDB Entry: 1tns

PDB Description: a novel class of winged helix-turn-helix protein: the dna-binding domain of mu transposase

PDB Compounds: (A:) mu-transposase

SCOPe Domain Sequences for d1tnsa_:

Sequence; same for both SEQRES and ATOM records:

>d1tnsa_ a.6.1.7 (A:) mu transposase, DNA-binding domain {Bacteriophage Mu [TaxId: 10677]}
melwvspkelanlpglpktsagviyvakkqgwqnrtragvkggkaieynanslpveakaa
lllrqgeietslgyfe

Timeline for d1tnsa_:

• d1tnsa_ first appeared (with stable ids) in SCOP 1.55, called d1tns__
  
• d1tnsa_ appears in SCOPe 2.07