| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) ![]() |
| Family a.6.1.7: Excisionase-like [46891] (2 proteins) kinked C-terminal helix |
| Protein mu transposase, DNA-binding domain [46892] (1 species) |
| Species Bacteriophage Mu [TaxId:10677] [46893] (4 PDB entries) |
| Domain d1tnsa_: 1tns A: [16228] |
PDB Entry: 1tns (more details)
SCOPe Domain Sequences for d1tnsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tnsa_ a.6.1.7 (A:) mu transposase, DNA-binding domain {Bacteriophage Mu [TaxId: 10677]}
melwvspkelanlpglpktsagviyvakkqgwqnrtragvkggkaieynanslpveakaa
lllrqgeietslgyfe
Timeline for d1tnsa_: