SCOPe 2.06: Domain d1yo3a1: 1yo3 A:1-83

Lineage for d1yo3a1 (1yo3 A:1-83)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.39: DLC [54647] (1 superfamily)
   core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342

4. Superfamily d.39.1: DLC [54648] (1 family)
   automatically mapped to Pfam PF01221

5. Family d.39.1.1: DLC [54649] (3 proteins)
   8 kDa dynein light chain, DLC8

6. Protein automated matches [190350] (4 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [188146] (2 PDB entries)

8. Domain d1yo3a1: 1yo3 A:1-83 [162271]
   Other proteins in same PDB: d1yo3a2, d1yo3b2, d1yo3c2
   automated match to d1f3ca_

Details for d1yo3a1

PDB Entry: 1yo3, 1.65 Å

PDB Description: 1.65 angstrom structure of the dynein light chain 1 from plasmodium falciparum

PDB Compounds: (A:) dynein light chain 1

SCOPe Domain Sequences for d1yo3a1:

Sequence; same for both SEQRES and ATOM records:

>d1yo3a1 d.39.1.1 (A:1-83) automated matches {Plasmodium falciparum [TaxId: 36329]}
vvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgsyv
thetknfiyfyigqvaillfksg

Timeline for d1yo3a1:

• d1yo3a1 first appeared in SCOPe 2.01, called d1yo3a_
  
• d1yo3a1 was called d1yo3a_ in SCOPe 2.05
  
• d1yo3a1 does not appear in SCOPe 2.07