Lineage for d1ylza_ (1ylz A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690900Protein automated matches [190161] (19 species)
    not a true protein
  7. 1690950Species Escherichia coli [TaxId:562] [187306] (41 PDB entries)
  8. 1690969Domain d1ylza_: 1ylz A: [162246]
    automated match to d1iysa_
    complexed with cb4, po4

Details for d1ylza_

PDB Entry: 1ylz (more details), 1.35 Å

PDB Description: X-ray crystallographic structure of CTX-M-14 beta-lactamase complexed with ceftazidime-like boronic acid
PDB Compounds: (A:) beta-lactamase CTX-M-14

SCOPe Domain Sequences for d1ylza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylza_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq
pqqnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d1ylza_:

Click to download the PDB-style file with coordinates for d1ylza_.
(The format of our PDB-style files is described here.)

Timeline for d1ylza_: