SCOP 1.61: Domain d1b6a_1: 1b6a 375-448

Lineage for d1b6a_1 (1b6a 375-448)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families)

5. Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)

6. Protein Methionine aminopeptidase, insert domain [46888] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46890] (4 PDB entries)

8. Domain d1b6a_1: 1b6a 375-448 [16223]
   Other proteins in same PDB: d1b6a_2

Details for d1b6a_1

PDB Entry: 1b6a, 1.6 Å

PDB Description: human methionine aminopeptidase 2 complexed with tnp-470

SCOP Domain Sequences for d1b6a_1:

Sequence; same for both SEQRES and ATOM records:

>d1b6a_1 a.4.5.25 (375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens)}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

Timeline for d1b6a_1:

• d1b6a_1 first appeared (with stable ids) in SCOP 1.55
  
• d1b6a_1 appears in SCOP 1.59
  
• d1b6a_1 appears in SCOP 1.63
  
• d1b6a_1 appears in the current release, SCOPe 2.08, called d1b6aa1