| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
| Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
| Protein automated matches [190196] (7 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186938] (11 PDB entries) |
| Domain d1yjxk_: 1yjx K: [162229] automated match to d1e58a_ complexed with cit, cl |
PDB Entry: 1yjx (more details), 2.8 Å
SCOPe Domain Sequences for d1yjxk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yjxk_ c.60.1.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqkr
airtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydvp
pppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrvl
iaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvrk
Timeline for d1yjxk_: