SCOPe 2.04: Domain d1yfka_: 1yfk A:

Lineage for d1yfka_ (1yfk A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein automated matches [190196] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186938] (11 PDB entries)

8. Domain d1yfka_: 1yfk A: [162191]
   automated match to d1e58a_
   complexed with cit, cl

Details for d1yfka_

PDB Entry: 1yfk, 2.7 Å

PDB Description: Crystal structure of human B type phosphoglycerate mutase

PDB Compounds: (A:) phosphoglycerate mutase 1

SCOPe Domain Sequences for d1yfka_:

Sequence; same for both SEQRES and ATOM records:

>d1yfka_ c.60.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqkr
airtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydvp
pppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrvl
iaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvrka
mea

Timeline for d1yfka_:

• d1yfka_ first appeared in SCOPe 2.01
  
• d1yfka_ appears in SCOPe 2.03
  
• d1yfka_ appears in SCOPe 2.05
  
• d1yfka_ appears in the current release, SCOPe 2.08